The Protein Folding Database
  Deposition
  Search
Adv. Search |
BLAST
  Menu
  PFD
  Links
  Login
Username:
Password:
Lost Password?
Register
Remember me?
  Statistics
Version: 2.2
Last Update: 8-Jun-2007
Entries: 296
Proteins: 70
Families: 53
Species: 30
ϕ values: 230 (5 proteins)
Locations of visitors to this page
  Latest Additions
ACBP (3 WT)
FRB (6 WT)
CI2 (3 WT, 202 mutants)
HPr (1 WT, 4 mutants)
Im7 (1 WT)
En-HD (1 WT)
Im9 (2 WT)
Abp1 SH3 (1 WT)
CheW (1 WT)
U1A (1 WT)
Powered by Mac OS X Server
Fulton et al (2005) Nucleic Acids Res. 33:D279-283  |  Fulton et al (2007) Nucleic Acids Res. 35:D304-307 About PFD | Help | Glossary
Folding Data
Expand All   |   Collapse All
Toggle printer friendly view

Note: A field with its data listed as "ND" denotes there is no data for that field.
[Measurement ID: 18] contact us to make corrections & updates to this data

Expand   Protein Data
Protein Name Ribosomal protein L23 (L23)
Oligomeric State Monomer
Folding Mechanism Not characterised
Intermediates 0
Phi Pattern No phi value analysis
SCOP Class Alpha+Beta   |   goto SCOP
SCOP Family L23p   |   goto SCOP

Expand   Construct Data
Species Thermus thermophilus (Thermus thermophilus)

goto 3D view
Sequence MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI

Blast PFD  |  Blast NCBI NR
Length 97
Molecular Weight 10718.8Da
Fusion None
PDB ID 1N88   |   goto PDB  
PDB Resolution NMR
Chain Any chain
Residues 1 - 96
SCOP ID 89815   |   goto SCOP
UniProt ID RL23_THETH   |   goto UniProt
Relative Contact Order 14.02

Expand   Publication Data
Publication Maxwell KL et al (2005) Protein folding: defining a "standard" set of experimental conditions and a preliminary kinetic data set of two-state proteins., Protein Science 14, 602-616  goto pubmed
Data type in publication Equilibrium & Kinetic   |   view other data in this publication

Expand   Graphical Analysis Data
Chevron Plot chevron plot for measurement 18
unfolding & refolding data
ln(kuH2O)
(s-1)		 ln(kfH2O)
(s-1)		 m‡-N
(kJ mol-1 M-1)		 m‡-D
(kJ mol-1 M-1)
-3.88 ± 0.07 2.02 ± 0.06 1.17 ± 0.02 -3.46 ± 0.09
Notes on Chevron Plot Calculating
Contact Order Plot Data Acyl Coenzyme A Binding Protein Hypothetical protein YjbJ from Escherichia coli E colicin binding Immunity Protein 7 (ImmE7*) E colicin binding Immunity Protein 9 (ImmE9) Lambda C1 repressor, DNA-binding domain E colicin binding Immunity Protein 9 (ImmE9) Acyl Coenzyme A Binding Protein Acyl Coenzyme A Binding Protein Internalin B, C-terminal domain Apo-azurin Chemotaxis protein CheW Fyn proto-oncogene tyrosine kinase, SH3 domain Alpha-Spectrin SH3 Domain c-src tyrosine kinase SH3 Domain Actin binding protein 1 SH3 domain Activation Domain Of Human Procarboxypeptidase A2 Chymotrypsin Inhibitor 2 Ribosomal protein L9 C-domain FK-506 binding protein Ribosomal protein L23 Acylphosphatase Ribosomal protein L9 N-domain Immunoglobulin-binding protein G Immunoglobulin light chain-binding domain of protein L c-Raf1 RBD Ribosomal protein S6 c-src tyrosine kinase SH2 domain Spliceosomal U1A protein Ubiquitin FK-506 binding protein Chymotrypsin Inhibitor 2 Chymotrypsin Inhibitor 2
generated contact order graph

Moving your mouse over a data point will display that protein's name.
Clicking on a data point will display folding data on that protein.
To view more data on a SCOP Class click on it's name in the legend.
Note: Mutant measurements do not have their data plotted on this graph, instead the data from wildtype is marked in red.

view notes on contact order

Expand   Equilibrium Data & Methods
Equilibrium Data
[Denaturant] Minimum
(M)		 [Denaturant] 50%
(M)		 mD-N (m)
(kJ mol-1 M-1)		 ∆GD-N (m)
(kJ mol-1)
ND ND -3.3 ± 0.5 21.2 ± 1.9
Probe Trp Fluorescence  what is this?
Pertubation Denaturant  what is this?
Technique Urea
Instrument Jasco J-810 Spectropolarimeter  what is this?
Temperature 298K
pH 7
Buffer 0.05M Phosphate
Protein Concentration ND

Expand   Kinetic Data & Methods
Kinetic Unfolding Data
[Denaturant] Minimum
(M)		 [Denaturant] Maximum
(M)		 ku
(s-1)		 lnku
(s-1)		 mu
(M-1)		 m‡-N
(kJ mol-1 M-1)
3.68 9 0.020651 ± 0.000050 (0M) -3.88 ± 0.07 (0M) ND 1.17 ± 0.02
Kinetic Folding Data
[Denaturant] Minimum
(M)		 [Denaturant] Maximum
(M)		 kfH2O
(s-1)		 ln(kfH2O)
(s-1)		 mf
(M-1)		 m‡-D
(kJ mol-1 M-1)
0.68 3.41 7.54 ± 0.01 2.02 ± 0.06 ND -3.46 ± 0.09
Probe Trp Fluorescence  what is this?
Pertubation Denaturant  what is this?
Technique Urea
Instrument Applied Photophysics SX.17MV Stopped-flow fluorimeter
Temperature 298K
pH 7
Buffer 0.05M Phosphate
Protein Concentration ND
Unfolding Fit Linear
Refolding Fit Linear

Expand   Notes & Comments on this measurement
Measurement Notes
Protein Notes Mainly antiparallel beta sheets (segregated alpha and beta regions)
Construct Notes CO calculated using PDB entry 1N88.
Equilibrium Notes L23. Maxwell et al 2005. U1A and L23. U1A was expressed in E. coli (C41) and purified on CM-Sepharose (Amersham Pharmacia) and S100 (Amersham Pharmacia). L23 was expressed in E. coli (BL21 DE3) and purified on SP-Sepharose (Amersham Pharmacia) and S100 (Amersham Pharmacia) and characterized as described (Hedberg & Oliveberg, 2004). Stopped flow measurements were carried out on an Applied Photophysics stopped-flow flourimeter (SX17MV). Equilibrium fluorescence data were collected on J-810 JASCO spectrometer (excitation 280 nm, emission above 300 nm). (LH, MO)
Kinetic Notes L23. Maxwell et al 2005. U1A and L23. U1A was expressed in E. coli (C41) and purified on CM-Sepharose (Amersham Pharmacia) and S100 (Amersham Pharmacia). L23 was expressed in E. coli (BL21 DE3) and purified on SP-Sepharose (Amersham Pharmacia) and S100 (Amersham Pharmacia) and characterized as described (Hedberg & Oliveberg, 2004). Stopped flow measurements were carried out on an Applied Photophysics stopped-flow flourimeter (SX17MV). Equilibrium fluorescence data were collected on J-810 JASCO spectrometer (excitation 280 nm, emission above 300 nm). (LH, MO)
Comments view comments on this measurement

contact us to make corrections & updates to this data