The Protein Folding Database
  Deposition
  Search
Adv. Search |
BLAST
  Menu
  PFD
  Links
  Login
Username:
Password:
Lost Password?
Register
Remember me?
  Statistics
Version: 2.2
Last Update: 8-Jun-2007
Entries: 296
Proteins: 70
Families: 53
Species: 30
ϕ values: 230 (5 proteins)
Locations of visitors to this page
  Latest Additions
ACBP (3 WT)
FRB (6 WT)
CI2 (3 WT, 202 mutants)
HPr (1 WT, 4 mutants)
Im7 (1 WT)
En-HD (1 WT)
Im9 (2 WT)
Abp1 SH3 (1 WT)
CheW (1 WT)
U1A (1 WT)
Powered by Mac OS X Server
Fulton et al (2005) Nucleic Acids Res. 33:D279-283  |  Fulton et al (2007) Nucleic Acids Res. 35:D304-307 About PFD | Help | Glossary

Folding Data
Expand All   |   Collapse All
Toggle printer friendly view

Note: A field with its data listed as "ND" denotes there is no data for that field.
[Measurement ID: 3] contact us to make corrections & updates to this data

Expand   Compare Data
compare with other measurements for this protein (2)compare with other measurements for proteins in this SCOP Family (4)

Expand   Protein Data
Protein Name Acyl Coenzyme A Binding Protein (ACBP)
Oligomeric State Monomer
Folding Mechanism Nucleation-condensation
Intermediates 0
Phi Pattern No phi value analysis
SCOP Class Alpha   |   goto SCOP
SCOP Family Acyl-Co A Binding Protein   |   goto SCOP

Expand   Construct Data
Species Bovine (Bos taurus)

goto 3D view
Sequence SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFK
GKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI

Blast PFD  |  Blast NCBI NR
Length 88
Molecular Weight 9895.25Da
Fusion None
PDB ID 1NTI   |   goto PDB  
PDB Resolution NMR
Chain Any chain
Residues 1 - 86
SCOP ID 47030   |   goto SCOP
UniProt ID ACBP_BOVIN   |   goto UniProt
Relative Contact Order 12.05

Expand   Publication Data
Publication Maxwell KL et al (2005) Protein folding: defining a "standard" set of experimental conditions and a preliminary kinetic data set of two-state proteins., Protein Science 14, 602-616  goto pubmed
Data type in publication Equilibrium & Kinetic   |   view other data in this publication

Expand   Graphical Analysis Data
Chevron Plot chevron plot for measurement 3
unfolding & refolding data
ln(kuH2O)
(s-1)		 ln(kfH2O)
(s-1)		 m‡-N
(kJ mol-1 M-1)		 m‡-D
(kJ mol-1 M-1)
-3.86 ± 0.02 6.96 ± 0.04 4.8 ± 0.09 -9.74 ± 0.09
Notes on Chevron Plot Calculating
Contact Order Plot Data Acyl Coenzyme A Binding Protein Hypothetical protein YjbJ from Escherichia coli E colicin binding Immunity Protein 7 (ImmE7*) E colicin binding Immunity Protein 9 (ImmE9) Lambda C1 repressor, DNA-binding domain E colicin binding Immunity Protein 9 (ImmE9) Acyl Coenzyme A Binding Protein Acyl Coenzyme A Binding Protein Internalin B, C-terminal domain Apo-azurin Chemotaxis protein CheW Fyn proto-oncogene tyrosine kinase, SH3 domain Alpha-Spectrin SH3 Domain c-src tyrosine kinase SH3 Domain Actin binding protein 1 SH3 domain Activation Domain Of Human Procarboxypeptidase A2 Chymotrypsin Inhibitor 2 Ribosomal protein L9 C-domain FK-506 binding protein Ribosomal protein L23 Acylphosphatase Ribosomal protein L9 N-domain Immunoglobulin-binding protein G Immunoglobulin light chain-binding domain of protein L c-Raf1 RBD Ribosomal protein S6 c-src tyrosine kinase SH2 domain Spliceosomal U1A protein Ubiquitin FK-506 binding protein Chymotrypsin Inhibitor 2 Chymotrypsin Inhibitor 2
generated contact order graph

Moving your mouse over a data point will display that protein's name.
Clicking on a data point will display folding data on that protein.
To view more data on a SCOP Class click on it's name in the legend.
Note: Mutant measurements do not have their data plotted on this graph, instead the data from wildtype is marked in red.

view notes on contact order

Expand   Equilibrium Data & Methods
Equilibrium Data
[Denaturant] Minimum
(M)		 [Denaturant] 50%
(M)		 mD-N (m)
(kJ mol-1 M-1)		 ∆GD-N (m)
(kJ mol-1)
ND ND -13.1 ± 0.3 23.7 ± 0.7
Probe Trp Fluorescence  what is this?
Pertubation Denaturant  what is this?
Technique GdnHCl
Instrument Perkin-Elmer LS50B Luminescence Spectrometer
Temperature 298K
pH 7
Buffer 0.05M Hepes
Protein Concentration 0.01M

Expand   Kinetic Data & Methods
Kinetic Unfolding Data
[Denaturant] Minimum
(M)		 [Denaturant] Maximum
(M)		 ku
(s-1)		 lnku
(s-1)		 mu
(M-1)		 m‡-N
(kJ mol-1 M-1)
2.03 3.17 0.0210680 ± 0.0000040 (0M) -3.86 ± 0.02 (0M) ND 4.8 ± 0.09
Kinetic Folding Data
[Denaturant] Minimum
(M)		 [Denaturant] Maximum
(M)		 kfH2O
(s-1)		 ln(kfH2O)
(s-1)		 mf
(M-1)		 m‡-D
(kJ mol-1 M-1)
0.53 1.92 1053.63 ± 0.84 6.96 ± 0.04 ND -9.74 ± 0.09
Probe Trp Fluorescence  what is this?
Pertubation Denaturant  what is this?
Technique GdnHCl
Instrument Bio-Logic SFM4/QFM4 Stopped-flow Fluorometer  what is this?
Temperature 298K
pH 7
Buffer 0.05M Hepes
Protein Concentration 0.01M
Unfolding Fit Linear
Refolding Fit Linear

Expand   Notes & Comments on this measurement
Measurement Notes
Protein Notes Four-helix boundle motif where the four alpha helices, A1 to A4 are arranged in a left handed up-down-down-up orientation with an overhand connection between A2 and A3. The helices interact mainly through hydrophobic interactions.
Construct Notes
Equilibrium Notes Bovine ACBP was obtained as described in Thomsen et al., 2002. Equilibrium unfolding data were collected using a Perkin-Elmer LS-50b fluorimeter with excitation and detection at 280 nm and 356 nm respectively.
Kinetic Notes Bovine ACBP was obtained as described in Thomsen et al., 2002. Stopped-flow kinetic experiments were performed using a Biologic SFM-400 attached to a Jasco J-810. Excitation was at 280 nm and fluorescence were measured with a 305 nm long-pass filter. The experiments were performed at 10 microM protein concentration.
Comments view comments on this measurement

contact us to make corrections & updates to this data